DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and SPAC22A12.17c

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_593247.1 Gene:SPAC22A12.17c / 2541844 PomBaseID:SPAC22A12.17c Length:261 Species:Schizosaccharomyces pombe


Alignment Length:260 Identity:77/260 - (29%)
Similarity:130/260 - (50%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENL---KKVAAECSKVSQSQPALVVG 62
            ::..||..::.|.:.|||.|....||:.||    |...|.|.   :|.|.|.::.:..:......
pombe    17 LSLKGKNAVVFGGARGIGHAICSVFAEAGA----NAFIVYNTTPGEKAAKEIAQANGVKTYTCKC 77

  Fly    63 DIAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATP 127
            |:....:.:..::|..:.:..:|::|.|.||....:....:.|::...:|.||..::::...|.|
pombe    78 DVTIPKEVEHAFAEIQKVFDTIDIVVPNNGICTGKSAIDMTYEEFANEINVNLLGVFNVAHNAGP 142

  Fly   128 ELVKT-KGNIVNVSSVNGIRSFPGVL-------AYNISKMGVDQFTRCVALELAAKGVRVNCVNP 184
            ...|. .|::|..:|::|:     |:       |||.||.||.|..:.:|:|. .|..|||||:|
pombe   143 IFQKQGHGSLVATASMSGV-----VVNVPQQQCAYNTSKAGVIQLIKSLAVEW-RKFARVNCVSP 201

  Fly   185 GVTVTNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            |.|.:::  .||       ||.:..:......|.|..||:|:|..:||||.||:::|.:|.||||
pombe   202 GYTTSDM--TGG-------KFHKEWEPYTPFERNGLAKEIASAYLYLASDAASYASGTNLIVDGG 257

  Fly   250  249
            pombe   258  257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 77/260 (30%)
NADB_Rossmann 3..253 CDD:304358 77/258 (30%)
SPAC22A12.17cNP_593247.1 MDH-like_SDR_c 14..260 CDD:187610 77/260 (30%)
fabG 18..257 CDD:235500 75/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.