DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Rdh8

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001025461.1 Gene:Rdh8 / 235033 MGIID:2685028 Length:317 Species:Mus musculus


Alignment Length:248 Identity:65/248 - (26%)
Similarity:110/248 - (44%) Gaps:32/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFA-----KYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIA 65
            :.|||:|.|||||...|::.|     :|.....:  |::...:.:.|...:......::|..|:.
Mouse     6 RTVLISGCSSGIGLELALQLAHDPRQRYQVVATM--RDLGKKEPLEAAAGEALGKTLSVVQLDVC 68

  Fly    66 KEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELV 130
            .:.......|..  :.|::||||||||:...|.:|..||.....|.|||......|.....|.:.
Mouse    69 NDESVTDCLSHI--EGGQVDVLVNNAGVGLVGPLEGLSLATMQSVFNTNFFGAVRLVKAVLPGMK 131

  Fly   131 KTK-GNIVNVSSVNGIRSFPGVL---AYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNL 191
            :.: |:||.||||.|::   ||:   .|..||..::.|...:|::|....:.::.|.||...|:.
Mouse   132 RRRQGHIVVVSSVMGLQ---GVMFNDVYAASKFALEGFFESLAIQLRQFNIFISMVEPGPVTTDF 193

  Fly   192 HAR----------GGMDAETYKKFLE-----HSKTTHALGR-PGDVKEVAAAI 228
            ..:          ...|.:|...|.:     ..:...::|: |.||.:|.|.:
Mouse   194 EGKLLAQVSKAEFPDTDPDTLGYFRDLYLPASRELFRSVGQSPRDVAQVIAKV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 65/248 (26%)
NADB_Rossmann 3..253 CDD:304358 65/248 (26%)
Rdh8NP_001025461.1 NADB_Rossmann 6..263 CDD:304358 65/248 (26%)
adh_short 6..201 CDD:278532 56/201 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.