DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Cbr4

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_663570.2 Gene:Cbr4 / 234309 MGIID:2384567 Length:236 Species:Mus musculus


Alignment Length:255 Identity:87/255 - (34%)
Similarity:120/255 - (47%) Gaps:37/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAE---------CSKVSQSQPALVV 61
            ||..:.|.|.|||.|.|...|:.|..||:..||:|..|..|.|         |            
Mouse     3 KVCAVFGGSRGIGRAVAQLMAQKGYRLAIVSRNLEVAKVTAGELGGNHLAFRC------------ 55

  Fly    62 GDIAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLAT 126
             |:|||.|.|..:.|..:..|.::.|||.|||.....:..|..|.....::|||.........|.
Mouse    56 -DVAKEQDVQSTFQEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMISQLHTNLLGSMLTCKAAM 119

  Fly   127 PELVKTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNL 191
            ..:::..|:||||.|:.|::...|..||:.:|.|:..|:|.:|.|:|.|.:|||.|.||...|::
Mouse   120 KTMIQQGGSIVNVGSIIGLKGNVGQSAYSATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDM 184

  Fly   192 --HARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
              |.:.           ||.|....|||.|:..|||.|:.||.  |:.:.||..|.||||
Mouse   185 TRHLKE-----------EHFKKNIPLGRFGETLEVAHAVVFLL--ESPYITGHVLIVDGG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 87/255 (34%)
NADB_Rossmann 3..253 CDD:304358 87/255 (34%)
Cbr4NP_663570.2 fabG 1..234 CDD:235546 87/255 (34%)
NADB_Rossmann 3..232 CDD:304358 87/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.