DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_663403.1 Gene:Dhrs7b / 216820 MGIID:2384931 Length:323 Species:Mus musculus


Alignment Length:208 Identity:75/208 - (36%)
Similarity:107/208 - (51%) Gaps:13/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQS---QPALVVGDIAKEA 68
            ||::|||:||:|...|..|...||.|.|.||||:.|::::.|.:..||.   ||.:|..|:|...
Mouse    54 VVVVTGATSGLGRECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQGQTHQPFVVTFDLADPG 118

  Fly    69 DTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKTK 133
            ......:|.||.:|.:|||:|||||...|||..|.::...:||..|......||....|.:|:.|
Mouse   119 TIAAAAAEILQCFGYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKALLPSMVERK 183

  Fly   134 -GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHAR--- 194
             |:||.:||:.|..|.|...||:.||.....|..|:..|:....::|..::||...|||...   
Mouse   184 QGHIVAISSIQGKISIPFRSAYSASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNLSVNAVT 248

  Fly   195 ------GGMDAET 201
                  |.:|..|
Mouse   249 ADGSRYGALDKNT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 75/208 (36%)
NADB_Rossmann 3..253 CDD:304358 75/208 (36%)
Dhrs7bNP_663403.1 11beta-HSD1_like_SDR_c 50..309 CDD:187593 75/208 (36%)
PRK06181 52..319 CDD:235726 75/208 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.