Sequence 1: | NP_730974.1 | Gene: | CG31548 / 318794 | FlyBaseID: | FBgn0051548 | Length: | 256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_663403.1 | Gene: | Dhrs7b / 216820 | MGIID: | 2384931 | Length: | 323 | Species: | Mus musculus |
Alignment Length: | 208 | Identity: | 75/208 - (36%) |
---|---|---|---|
Similarity: | 107/208 - (51%) | Gaps: | 13/208 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 VVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQS---QPALVVGDIAKEA 68
Fly 69 DTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKTK 133
Fly 134 -GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHAR--- 194
Fly 195 ------GGMDAET 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31548 | NP_730974.1 | fabG | 1..250 | CDD:235975 | 75/208 (36%) |
NADB_Rossmann | 3..253 | CDD:304358 | 75/208 (36%) | ||
Dhrs7b | NP_663403.1 | 11beta-HSD1_like_SDR_c | 50..309 | CDD:187593 | 75/208 (36%) |
PRK06181 | 52..319 | CDD:235726 | 75/208 (36%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830578 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |