DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and R05D8.9

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_503753.1 Gene:R05D8.9 / 187609 WormBaseID:WBGene00019886 Length:281 Species:Caenorhabditis elegans


Alignment Length:263 Identity:108/263 - (41%)
Similarity:152/263 - (57%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSK--VSQSQPALVVGDIA 65
            |:|||.|:||:|:|||.|.|:.|||.||.:.:.|||.|.|::...|..|  |.:|....|..|:|
 Worm     5 FSGKVALVTGSSNGIGRAAAVLFAKDGAKVTVTGRNAERLEETRQEILKSGVPESHVLSVATDLA 69

  Fly    66 KEADTQRIWSETLQQYGKLDVLVNNAGII------ETGTIETTSLEQYDRVMNTNLRAIYHLTML 124
            .|.....:.:.|:|::|:||:||||||..      ..|..:..|:  ||::|..|:|::..||..
 Worm    70 AEKGQDELVNSTIQKFGRLDILVNNAGAAFNDDQGRVGVDQDVSV--YDKIMQINMRSVVTLTQK 132

  Fly   125 ATPELVKTKGNIVNVSSVNG-IRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTV 188
            |...|||.||.||||||:.| ..:.|||:.|.:||..:||||||.|::|...|||||.|:||...
 Worm   133 AKEHLVKAKGEIVNVSSIAGTAHAQPGVMYYAMSKSALDQFTRCAAIDLIQYGVRVNSVSPGGVT 197

  Fly   189 TNLHARGGMDA---ETYKKFLEHSK---TTHALGRPGDVKEVAAAIAFLASDE-ASFSTGVSLPV 246
            |......||.:   |...||:|..|   .:.|:.:|.|:..:   |||||..: :|:..|.|:..
 Worm   198 TGFGEAMGMPSGAFEEMMKFMESRKECIPSGAVAKPIDIANI---IAFLADRKLSSYIIGQSIVA 259

  Fly   247 DGG 249
            |||
 Worm   260 DGG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 108/263 (41%)
NADB_Rossmann 3..253 CDD:304358 108/263 (41%)
R05D8.9NP_503753.1 fabG 4..266 CDD:235975 108/263 (41%)
NADB_Rossmann 5..266 CDD:304358 108/263 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.