DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and stdh-4

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001355440.1 Gene:stdh-4 / 184934 WormBaseID:WBGene00006435 Length:317 Species:Caenorhabditis elegans


Alignment Length:199 Identity:50/199 - (25%)
Similarity:90/199 - (45%) Gaps:26/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAE-CSKVSQSQPALVVGDIAKEA--DT 70
            ::|||:.|||.:.|:..|:.|..:.|..|....|.|...: .:|.|..:....:.|..:.:  |.
 Worm    57 VVTGATDGIGRSYALDLARRGFNIFLISRTKSKLVKTKKQILNKYSDIEVRYAICDFTRVSYEDY 121

  Fly    71 QRIWSETLQQYGKLD--VLVNNAGI----------IETGTIETTSLEQYDRVMNTNLRAIYHLTM 123
            :|:    |....::|  :|:||.|:          :| |.|:|.:     .|:|.|:..:..||.
 Worm   122 KRL----LHSLNEVDIGILINNVGMCFDNPEVLHRVE-GGIDTLT-----NVINVNILPVTLLTA 176

  Fly   124 LATPELVKTK-GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVT 187
            ...|:::..| |.|||:.|..|.........|:.:|..::.||..:..|...:|:....:.|.:.
 Worm   177 GILPQMMARKSGIIVNIGSAAGSIHMAKWSVYSATKKYIEWFTSILQKEYENEGIICQTITPLLV 241

  Fly   188 VTNL 191
            .||:
 Worm   242 STNM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 50/199 (25%)
NADB_Rossmann 3..253 CDD:304358 50/199 (25%)
stdh-4NP_001355440.1 17beta-HSD1_like_SDR_c 53..295 CDD:187614 50/199 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.