DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and F20G2.2

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_506407.1 Gene:F20G2.2 / 184743 WormBaseID:WBGene00008986 Length:249 Species:Caenorhabditis elegans


Alignment Length:241 Identity:60/241 - (24%)
Similarity:105/241 - (43%) Gaps:51/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAEC---------SKVSQSQPALVV 61
            |.:|||||:.|||.....:|.|:           ::::.:.|.|         |.:..|:..::.
 Worm     4 KSLLITGANRGIGLGLLKQFLKH-----------KDIQIIIATCRDPSKAEELSNLKDSRLHILP 57

  Fly    62 GDIAKEADTQRIWSETLQQYGK--LDVLVNNAGIIETGTIE-TTSLEQYDRVMNTNLRAIYHLTM 123
            .||..:....::::|..:..|:  |.||:|||||:....:| ..:.:...|.:.||..:...:|.
 Worm    58 LDIDCDESISKLYAEVEKLVGEDGLTVLLNNAGILLPYDVEGEKNRKTLIRQLETNSVSTALITQ 122

  Fly   124 LATPELVK------------TKGNIVNVSS-------VNGIRSFPGVLAYNISKMGVDQFTRCVA 169
            ...|.|.|            .:..|||:||       ::|..:.| ::||.:||..::.|.:..:
 Worm   123 EFLPLLKKAAAKNGGDGYSINRAAIVNISSTAASVEKIDGTFNGP-LVAYRMSKSALNSFAKSCS 186

  Fly   170 LELAAKGVRVNCVNPGVTVTNLHARGGMDAETYKKFLEHSKTTHAL 215
            ::||...:.|....||...|.:   ||.:|     .||....|..|
 Worm   187 IDLAKYHILVTSFCPGWVKTGM---GGANA-----MLEIEDATKTL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 60/241 (25%)
NADB_Rossmann 3..253 CDD:304358 60/241 (25%)
F20G2.2NP_506407.1 carb_red_sniffer_like_SDR_c 7..248 CDD:187586 59/238 (25%)
adh_short 7..208 CDD:278532 52/212 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.