DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and dhs-26

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_508580.2 Gene:dhs-26 / 180624 WormBaseID:WBGene00000989 Length:321 Species:Caenorhabditis elegans


Alignment Length:324 Identity:84/324 - (25%)
Similarity:129/324 - (39%) Gaps:91/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFAGKVVLITGASSGIGAATAIKFAKYGACLALNGR-----------NVENLKKVAAECSK--- 51
            |:...|:.::||||.|.|...|::.|:.|..|.:.||           .:..|:..|.||.|   
 Worm     1 MSLKSKIAIVTGASRGCGRGVALQLAEAGCTLYITGRAPSKTLSSELTYLPTLEGTAEECRKRGG 65

  Fly    52 ------VSQSQPALV---VGDIAKEADTQRIWSETLQQYGKLDVLVNNA--GIIETGTIETTSL- 104
                  |..|....|   ..::|.|.|.|            ||:|||||  .:.:.|:.:|... 
 Worm    66 ICHVRYVDHSNMDEVEKFFDEVASETDNQ------------LDILVNNAFSAVTKCGSGDTRKFF 118

  Fly   105 ----EQYDRVMNTNLRAIYHLTMLATPELVKT--KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQ 163
                |.:|.:.|..||..|:.::..|..:.|.  ||.|||:||:.|| .:...:||.:.||.:|:
 Worm   119 ERDPEIWDDINNVGLRNQYYCSVYGTRIMRKNGMKGLIVNISSLGGI-MYLFTVAYGVGKMALDR 182

  Fly   164 FTRCVALELAAKGVRVNCVNPGVTVTNL------HARGGMDAETYKKFLEHSKTTHALGRPGDVK 222
            .:..:|.||...|:.|..:.|....|.|      .:.|...|...|.|| :.::|...|:     
 Worm   183 MSSDMAQELQDTGITVISLWPSAVKTELITNMIETSAGSWGATENKMFL-NGESTEYCGK----- 241

  Fly   223 EVAAAIAFLASDEASFSTGVSL------------PVDG----------------GRHAM---CP 255
               |.:|..|..:..:..|.:|            .:||                |.|:|   ||
 Worm   242 ---AVVAIAADPKKKYWNGSTLITTDMGNYYSYTDIDGRIPTNMRQLRGLLSLAGYHSMAGWCP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 79/314 (25%)
NADB_Rossmann 3..253 CDD:304358 80/315 (25%)
dhs-26NP_508580.2 PRK08303 1..286 CDD:236229 79/306 (26%)
DHRS1-like_SDR_c 3..278 CDD:187664 78/296 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.