DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and DECR1

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001350.1 Gene:DECR1 / 1666 HGNCID:2753 Length:335 Species:Homo sapiens


Alignment Length:259 Identity:64/259 - (24%)
Similarity:111/259 - (42%) Gaps:15/259 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAK 66
            :|.|||..|||..:|:|.......:..||...:..|.::.||..|.:.|..:.::...:..|:..
Human    56 SFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRD 120

  Fly    67 EADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK 131
            ....|...||.::..|..::::|||........|..|...:..:.:..|.....:|:....:|:|
Human   121 PDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIK 185

  Fly   132 T-KG-NIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVT----- 189
            . || ..::::::........|:....:|.||:..::.:|.|....|:|.|.:.||...|     
Human   186 AQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFS 250

  Fly   190 NLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGRHAM 253
            .|...|..:.|...:.        ..||.|.|:|:|...|||.||.||:..|..:..|||...:
Human   251 RLDPTGTFEKEMIGRI--------PCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 63/254 (25%)
NADB_Rossmann 3..253 CDD:304358 64/256 (25%)
DECR1NP_001350.1 TER_DECR_SDR_a 57..303 CDD:187627 63/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.