DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Hsd11b1

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006497291.1 Gene:Hsd11b1 / 15483 MGIID:103562 Length:304 Species:Mus musculus


Alignment Length:262 Identity:73/262 - (27%)
Similarity:114/262 - (43%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            ||.|::||||.|||...|...:|.||.:.|..|:.|.|:||.:.|.::..:....:.|.:.....
Mouse    46 GKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTF 110

  Fly    70 TQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYD-------RVMNTNLRAIYHLTMLATP 127
            .::...:..:..|.||:|:.|       .|..|||..:.       |||..|..:...::..|.|
Mouse   111 AEQFIVKAGKLMGGLDMLILN-------HITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALP 168

  Fly   128 ELVKTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLH 192
            .|.::.|:|..:||:.|..:.|.:..|:.||..:|.|...:..||     .:..||..:|:..| 
Mouse   169 MLKQSNGSIAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTEL-----YITKVNVSITLCVL- 227

  Fly   193 ARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAI---AFLASDEASFSTGVSLPV---DGGRH 251
              |.:|.||..|  |.|...:|...|.:  |.|..|   ..|...|..:......|:   :.||.
Mouse   228 --GLIDTETAMK--EISGIINAQASPKE--ECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRK 286

  Fly   252 AM 253
            .|
Mouse   287 IM 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 70/257 (27%)
NADB_Rossmann 3..253 CDD:304358 72/260 (28%)
Hsd11b1XP_006497291.1 11beta-HSD1_like_SDR_c 44..291 CDD:187593 73/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.