DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and H2-Ke6

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_038571.2 Gene:H2-Ke6 / 14979 MGIID:95911 Length:259 Species:Mus musculus


Alignment Length:252 Identity:77/252 - (30%)
Similarity:124/252 - (49%) Gaps:15/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLITGASSGIGAATAIKFAKYGACLA---LNGRNVENLKKVAAECSK---VSQSQPALVVGDIA 65
            :.|:|||.||||.|.:::.|..||.:|   |:|...::..::......   ..:.:.|....|::
Mouse    11 LALVTGAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGSPGSEDGAPRGKHAAFQADVS 75

  Fly    66 KEADTQRIWSETLQQYGK-LDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPEL 129
            :....:|:..|....:.: ..|:|:.|||.....:...|.|.:|||:..||:..:.:|..|...|
Mouse    76 QGPAARRLLEEVQACFSRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQAL 140

  Fly   130 VKT--KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLH 192
            |.:  :|:|:|:||:.|.....|...|..||.||...|:..|.||...|:|.|.|.||...|   
Mouse   141 VSSGGRGSIINISSIIGKVGNIGQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIAT--- 202

  Fly   193 ARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
               .|..:..:|..:.......||..||.::||..:|||||:::.:.||.|:.|.||
Mouse   203 ---PMTQKMPEKVKDKVTAMIPLGHMGDPEDVADVVAFLASEDSGYITGASVEVSGG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 77/252 (31%)
NADB_Rossmann 3..253 CDD:304358 77/252 (31%)
H2-Ke6NP_038571.2 NADB_Rossmann 11..258 CDD:304358 77/252 (31%)
fabG 12..259 CDD:235546 77/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.