DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Decr1

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_476545.2 Gene:Decr1 / 117543 RGDID:70999 Length:335 Species:Rattus norvegicus


Alignment Length:259 Identity:66/259 - (25%)
Similarity:108/259 - (41%) Gaps:25/259 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKE 67
            |.|||..|||..:|:|.|.....:..||...:..||::.||..|.|.:..:.::...:..|:...
  Rat    57 FQGKVAFITGGGTGLGKAMTTFLSSLGAQCVIASRNIDVLKATAEEITSKTGNKVYAIRCDVRDP 121

  Fly    68 ADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKT 132
            ........|.::..|..||::|||........|..|...:..:.:..|....::|:....:|:|.
  Rat   122 DMVHNTVLELIKVAGHPDVVINNAAGNFISPSERLSPNGWKTITDIVLNGTAYVTLEIGKQLIKA 186

  Fly   133 -KG------NIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVT- 189
             ||      ..:...|.:|.     |:..:.:|.||:...:.:|.|....|:|.|.:.||...| 
  Rat   187 QKGAAFLAITTIYAESGSGF-----VMPSSSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKTK 246

  Fly   190 ----NLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
                .|...|..:.:..::.        ..||.|.|:|:|....||.||.||:..|..:..|||
  Rat   247 GAFSRLDPTGKFEKDMIERI--------PCGRLGTVEELANLATFLCSDYASWINGAVIRFDGG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 66/259 (25%)
NADB_Rossmann 3..253 CDD:304358 66/259 (25%)
Decr1NP_476545.2 TER_DECR_SDR_a 57..303 CDD:187627 66/259 (25%)
PRK07677 59..303 CDD:181077 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.