DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and DHRS1

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001129522.1 Gene:DHRS1 / 115817 HGNCID:16445 Length:313 Species:Homo sapiens


Alignment Length:264 Identity:78/264 - (29%)
Similarity:119/264 - (45%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIA 65
            ||  |:|.::||||.|||...|::..|.||.:.:.||:::.|:.||.|...:. .|...||.|.:
Human     5 MN--GQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLG-GQCVPVVCDSS 66

  Fly    66 KEADTQRIWSET-LQQYGKLDVLVNNA-----GIIET--GTIETTSLEQYDRVMNTNLRAIYHLT 122
            :|::.:.::.:. .:|.|:||||||||     .|:.|  .....|....:|.:.|..||..|..:
Human    67 QESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCS 131

  Fly   123 MLATPELVKT-KGNIVNVSSVNGIRSFPGVL------AYNISKMGVDQFTRCVALELAAKGVRVN 180
            :.....:|.. :|.||.:||       ||.|      .|.:.|...|:.....|.||...|  |:
Human   132 VYGARLMVPAGQGLIVVISS-------PGSLQYMFNVPYGVGKAACDKLAADCAHELRRHG--VS 187

  Fly   181 CVN--PGVTVTNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVS 243
            ||:  ||:..|.|             ..||......|..| .:|:..:|.:...:.|.|....|:
Human   188 CVSLWPGIVQTEL-------------LKEHMAKEEVLQDP-VLKQFKSAFSSAETTELSGKCVVA 238

  Fly   244 LPVD 247
            |..|
Human   239 LATD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 78/264 (30%)
NADB_Rossmann 3..253 CDD:304358 76/262 (29%)
DHRS1NP_001129522.1 PRK08303 1..271 CDD:236229 78/264 (30%)
DHRS1-like_SDR_c 5..271 CDD:187664 78/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.