DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Pecr

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_076012.3 Gene:Pecr / 111175 MGIID:2148199 Length:303 Species:Mus musculus


Alignment Length:263 Identity:72/263 - (27%)
Similarity:127/263 - (48%) Gaps:26/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENL----KKVAAECSKVSQSQPALVVGDIAK 66
            :|.::||..:|||.|.:.:....|..:.:..|.::.|    .::.|.....|.::.:.:..:|.|
Mouse    19 QVAVVTGGGTGIGKAVSRELLHLGCNVVIASRKLDRLTAAVDELRASLPPSSSAEVSAIQCNIRK 83

  Fly    67 EADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK 131
            |.:...:...||.:|||::.||||.|......:|..:.:.:..|:.|||...:::........::
Mouse    84 EEEVSNLVKSTLAKYGKINFLVNNGGGQFMAPVEDITAKGWHAVIETNLTGTFYMCKEVYNSWMR 148

  Fly   132 TK-GNIVNVSSV--NGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHA 193
            .. |:|||:..:  ||   ||.......::.||...|:.:||..|:.|||:|||.||    .:::
Mouse   149 EHGGSIVNIIVLLNNG---FPTAAHTGAAREGVYNLTKSMALAWASSGVRINCVAPG----TIYS 206

  Fly   194 RGGMD-----AETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGR--- 250
            :..:|     .:|..:....|.....||.|   :|::..:.||.|..||:.||..:.||||:   
Mouse   207 QTAVDNYGEMGQTLFEMAFDSIPAKRLGVP---EEISPLVCFLLSPAASYITGQLINVDGGQALY 268

  Fly   251 -HA 252
             ||
Mouse   269 THA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 69/255 (27%)
NADB_Rossmann 3..253 CDD:304358 72/263 (27%)
PecrNP_076012.3 fabG 32..267 CDD:235546 64/244 (26%)
TER_DECR_SDR_a 32..267 CDD:187627 64/244 (26%)
Microbody targeting signal. /evidence=ECO:0000250 301..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.