DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and DHRS4

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_066284.2 Gene:DHRS4 / 10901 HGNCID:16985 Length:278 Species:Homo sapiens


Alignment Length:251 Identity:80/251 - (31%)
Similarity:137/251 - (54%) Gaps:13/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVG---DIA 65
            |.||.|:|.::.|||.|.|.:.|:.||.:.::.|..:|:.:..|    ..|.:...|.|   .:.
Human    31 ANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVA----TLQGEGLSVTGTVCHVG 91

  Fly    66 KEADTQRIWSETLQQYGKLDVLVNNAGIIE-TGTIETTSLEQYDRVMNTNLRAIYHLTMLATPEL 129
            |..|.:|:.:..::.:|.:|:||:||.:.. .|:|...:.|.:|:.::.|::|...:|....||:
Human    92 KAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEM 156

  Fly   130 VKT-KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHA 193
            .|. .|::|.|||:......||...||:||..:...|:.:|:|||.:.:||||:.||:..|:...
Human   157 EKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSR 221

  Fly   194 RGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            ...||.|..    |..|.|..:.|.|:.::.|..::||.|::||:.||.::.|.||
Human   222 MLWMDKEKE----ESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 80/251 (32%)
NADB_Rossmann 3..253 CDD:304358 80/251 (32%)
DHRS4NP_066284.2 CR_SDR_c 23..278 CDD:187641 80/251 (32%)
fabG 30..273 CDD:235975 78/249 (31%)
Microbody targeting signal 276..278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140602
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.