DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and hsd17b14

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_002935043.1 Gene:hsd17b14 / 100498205 XenbaseID:XB-GENE-986127 Length:276 Species:Xenopus tropicalis


Alignment Length:260 Identity:81/260 - (31%)
Similarity:129/260 - (49%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIA 65
            :.:..:|.:|||.:.|||.|...:|.|.||.:....::.| .|.:..|...........|..|:.
 Frog    10 LRYRDRVAVITGGTKGIGEAMVKEFVKSGARVVFCSKDTE-AKALENEIKAAGPGDCIYVCCDVT 73

  Fly    66 KEADTQRIWSETLQQYGKLDVLVNNAG-IIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPEL 129
            ||.|.:::...|:..||::|.|:|||| .....||:.||.:.:..::|.||...:.....|.|.|
 Frog    74 KEEDIKKLIEITVMNYGQIDCLINNAGWHPPEQTIDGTSADDFRDLLNLNLIGYFLTAKYALPHL 138

  Fly   130 VKTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHAR 194
            .||:|||:|:||:.||......:.|..:|..|...|:.:|::.:...||:|.::||...|.|   
 Frog   139 RKTQGNIINISSLVGIIGQKHAIPYVATKGAVTAMTKAMAVDESRHNVRINSISPGNIWTPL--- 200

  Fly   195 GGMDAETYKKFLEHSKTTHA----------LGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
                   :::...|||.:.|          |||.|..:|.|.|..:||: |.:|.||:.|.:.||
 Frog   201 -------WEELSSHSKNSEAMIQGGIDAQLLGRMGTAEECAKAALYLAA-EGTFCTGIDLLLTGG 257

  Fly   250  249
             Frog   258  257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 81/260 (31%)
NADB_Rossmann 3..253 CDD:304358 81/258 (31%)
hsd17b14XP_002935043.1 NADB_Rossmann 6..265 CDD:389744 81/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.