DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and XB5863530

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_002941866.3 Gene:XB5863530 / 100497556 XenbaseID:XB-GENE-5863531 Length:346 Species:Xenopus tropicalis


Alignment Length:197 Identity:57/197 - (28%)
Similarity:100/197 - (50%) Gaps:15/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            |...::|||:.|||.:.|.:.|:.|..:.|..|:.|.|::||....:.|..:..::..|...:..
 Frog    78 GTWAVVTGATDGIGKSYAEELARRGFDIVLISRSPEKLQRVAEGIEQKSGRKTKIIQADYTGDVG 142

  Fly    70 TQRIWSETLQQYGKLDVLVNNAGI---------IETGTIETTSLEQYDRVMNTNLRAIYHLTMLA 125
            ......|.|:.. .:.|||||.|:         ::...::    |:...|:|.|:.::..:|.:.
 Frog   143 IYTPIEEGLKGL-DIGVLVNNVGMAYSNEPVRFLDVPNVK----ERLTNVINCNIVSVLQMTRIV 202

  Fly   126 TPELV-KTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVT 189
            .|.:: |.||.|:|:||..|...||.|..|:.:|:.||.|:||:..|.:.:|:.|..|.|.:..|
 Frog   203 LPGMLKKKKGLIINISSEAGSHPFPMVAVYSSTKVFVDYFSRCLHTEYSPQGITVQSVMPLLVST 267

  Fly   190 NL 191
            |:
 Frog   268 NM 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 57/197 (29%)
NADB_Rossmann 3..253 CDD:304358 57/197 (29%)
XB5863530XP_002941866.3 17beta-HSD1_like_SDR_c 78..315 CDD:187614 57/197 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.