Sequence 1: | NP_730974.1 | Gene: | CG31548 / 318794 | FlyBaseID: | FBgn0051548 | Length: | 256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009297199.1 | Gene: | hsd11b1lb / 100333777 | ZFINID: | ZDB-GENE-101130-4 | Length: | 281 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 63/198 - (31%) |
---|---|---|---|
Similarity: | 100/198 - (50%) | Gaps: | 10/198 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
Fly 70 TQRIWSETLQQYGKLDVLV-NNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKTK 133
Fly 134 GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGGMD 198
Fly 199 AET 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31548 | NP_730974.1 | fabG | 1..250 | CDD:235975 | 63/198 (32%) |
NADB_Rossmann | 3..253 | CDD:304358 | 63/198 (32%) | ||
hsd11b1lb | XP_009297199.1 | NADB_Rossmann | 28..273 | CDD:304358 | 63/198 (32%) |
adh_short | 33..226 | CDD:278532 | 62/195 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573254 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |