DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and hsd11b1lb

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_009297199.1 Gene:hsd11b1lb / 100333777 ZFINID:ZDB-GENE-101130-4 Length:281 Species:Danio rerio


Alignment Length:198 Identity:63/198 - (31%)
Similarity:100/198 - (50%) Gaps:10/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            |..|||||||||||...|..:||:||.:.:..|.:|.||||..:|.|:...:...|.||::..||
Zfish    30 GTRVLITGASSGIGEQMAYHYAKFGAEIVITARRLEALKKVTQKCEKLGAKKIMYVTGDMSDPAD 94

  Fly    70 TQRIWSETLQQYGKLDVLV-NNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKTK 133
            .:|:...|:::.|.||.|| |:.|....| :.....:....:|..|..:...:...|.|.|..:.
Zfish    95 PERVLKYTIEKLGGLDFLVLNHVGNTNVG-LWNRDADHVRSLMQVNFVSYVQMAGAALPVLETSG 158

  Fly   134 GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGGMD 198
            |:|:.|||:.|..:.|.|..|:.:|..::.|...:..|||.:...|:        .::...|.:|
Zfish   159 GSIIVVSSLAGKIASPFVTPYSSTKFAMNGFFGALQKELAIQKSNVS--------VSIQILGLID 215

  Fly   199 AET 201
            .|:
Zfish   216 TES 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 63/198 (32%)
NADB_Rossmann 3..253 CDD:304358 63/198 (32%)
hsd11b1lbXP_009297199.1 NADB_Rossmann 28..273 CDD:304358 63/198 (32%)
adh_short 33..226 CDD:278532 62/195 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573254
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.