DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and dhrs7c

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_012826975.2 Gene:dhrs7c / 100135266 XenbaseID:XB-GENE-5956201 Length:704 Species:Xenopus tropicalis


Alignment Length:244 Identity:70/244 - (28%)
Similarity:110/244 - (45%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQ----PALVVGDIAK 66
            |||:||.|.||:|...:..|...||.|.|.|:..|.|:.:......|:...    |.||:.||:.
 Frog    38 KVVVITDAISGLGKECSRVFHSAGARLVLCGKTWEKLEALHDALISVADPSVTFTPKLVLLDISD 102

  Fly    67 EADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK 131
            ..:.:.:..|....||.:|||:|||.:...|.:::.|||...::|:.|......|.....|.::.
 Frog   103 INNMEAMGKEIQDCYGCVDVLINNASMKMKGPLQSVSLELDKKIMDANYFGPITLVKAILPHMIS 167

  Fly   132 TK-GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHAR- 194
            .: |.||.|:::.|....|...||..||..:..|..|:..|:....|.|:.|:| ..:.:.|.: 
 Frog   168 RRTGQIVLVNTIQGKIGVPFRAAYAASKHAIQGFFDCLRAEVEEFDVSVSTVSP-TFIRSYHVQP 231

  Fly   195 --GGMDAETYKKFL------------EHSKTTHALGRPG-DVKEVAAAI 228
              |..:|..:|...            ...:.|.|.|.|. :|:|.|.||
 Frog   232 QPGNWEASIWKWIFYRVAMESPACVASRGQGTAAHGAPTCNVQEKANAI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 70/244 (29%)
NADB_Rossmann 3..253 CDD:304358 70/244 (29%)
dhrs7cXP_012826975.2 11beta-HSD1_like_SDR_c 35..257 CDD:187593 61/219 (28%)
LAP2alpha 425..629 CDD:371604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.