DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and XB1000829

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001096251.1 Gene:XB1000829 / 100124812 XenbaseID:XB-GENE-1000830 Length:323 Species:Xenopus tropicalis


Alignment Length:254 Identity:75/254 - (29%)
Similarity:115/254 - (45%) Gaps:50/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVG------ 62
            |.|.|||||.|||||.|.|.|.|          |:.:...||.|....::: |..|:..      
 Frog     2 AQKTVLITGCSSGIGLAIATKLA----------RDEQKRFKVYATMRNLAK-QDDLIAATEGYLG 55

  Fly    63 --------DIAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIY 119
                    |:..|...:...|....::  :|:||:|||:...|.||..::|:...||:||...:.
 Frog    56 KTMEIKEMDVCCEDSIRNCVSSIPDRH--IDILVSNAGVGLIGPIECQTIEEMKTVMDTNFFGLV 118

  Fly   120 HLTMLATPELVKTK-GNIVNVSSVNGIRSFPGVL---AYNISKMGVDQFTRCVALELAAKGVRVN 180
            .|.....|::.:.| |:||.:|||.||:   |:|   .|..||..|:.|...:|::.....:.::
 Frog   119 RLLKETLPDMKRRKSGHIVIISSVMGIQ---GILFNDVYAASKFAVEGFCESLAIQALKFKLHLS 180

  Fly   181 CVNPGVTVTNLHAR---GGM-------DAETYKKF----LEHSKTT-HALGRPG-DVKE 223
            .:.||..||....:   .||       |.||...|    |::.|:. .:||:.. ||.|
 Frog   181 LIEPGPVVTEFERKVFEDGMKMDLSAADKETADMFTNIYLKNYKSIFQSLGQTAEDVAE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 75/254 (30%)
NADB_Rossmann 3..253 CDD:304358 75/254 (30%)
XB1000829NP_001096251.1 type1_17beta-HSD-like_SDR_c 4..261 CDD:187666 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.