DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and hsd11b1l.2

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_004910661.1 Gene:hsd11b1l.2 / 100038278 XenbaseID:XB-GENE-5834068 Length:291 Species:Xenopus tropicalis


Alignment Length:228 Identity:70/228 - (30%)
Similarity:108/228 - (47%) Gaps:17/228 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            ||.|||||:|:|||...|.:||:.||.:.|..|..:.|::||.:|.|:..:....|..|:.....
 Frog    33 GKRVLITGSSTGIGEQIAYEFAQMGAHIMLTARRHQRLQEVANQCLKLGAASADYVASDMGNLTS 97

  Fly    70 TQRIWSETLQQYGKLDVLVNN--AGIIETGTIETTSLEQYDRVMNT---NLRAIYHLTMLATPEL 129
            .|.:..||:::.|.||.||.|  .|....|..:    ...|.|:.:   |..:...||..|...|
 Frog    98 AQYVAQETVKKLGGLDYLVLNHIGGSASFGFFK----GDMDPVVGSITINFLSYVQLTSTALRAL 158

  Fly   130 VKTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHAR 194
            .:::|:||.:||::|....|...:|..||..::.|...:..|.   .::.|  |..|||..|   
 Frog   159 QESQGSIVVMSSMSGRIGAPFTTSYCASKFALEGFYSSLRREF---DLQKN--NMSVTVAIL--- 215

  Fly   195 GGMDAETYKKFLEHSKTTHALGRPGDVKEVAAA 227
            |.:|.|...|.:.:..|..|..:....:||..|
 Frog   216 GYIDTENAVKKVGNKVTMTASSKEDCAREVVKA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 70/228 (31%)
NADB_Rossmann 3..253 CDD:304358 70/228 (31%)
hsd11b1l.2XP_004910661.1 11beta-HSD1_like_SDR_c 31..280 CDD:187593 70/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.