DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17440 and SPP1

DIOPT Version :9

Sequence 1:NP_572555.1 Gene:CG17440 / 31879 FlyBaseID:FBgn0030120 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_015187.1 Gene:SPP1 / 855965 SGDID:S000006059 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:271 Identity:52/271 - (19%)
Similarity:94/271 - (34%) Gaps:106/271 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YCICRSSDCSRFMIGCDGCEEWYHGDCIEITEKDAEHIKNYYCRRCKKENPELQTIFRLVATERA 104
            ||||:..|....|:|||||::|:|..|:.|.|:..:.:.::||..|                   
Yeast    24 YCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYC------------------- 69

  Fly   105 AASNAASTSLNAPGVGPSGAAPAAAPVAPATTSQQAPPPTTAAAKRKNSSAQEPKESQPTQAG-T 168
                                                                        ||| |
Yeast    70 ------------------------------------------------------------QAGIT 74

  Fly   169 KRDKAAPKTSNVQVSPRAVSPEIFLNPELQGIQQCHGPNCCSHARPQSKYCSDECGSNLAIERLF 233
            .::|.|           .::.|..| |:....::|...:|.......|||||:|.|... :..::
Yeast    75 GKNKDA-----------IINGEGSL-PKTLWKRKCRISDCYKPCLQDSKYCSEEHGREF-VNDIW 126

  Fly   234 QILPQQMQEWNITPSRAAEET------RKHLELNM--DELVLKQQEQLEEFEK---QRQQIQTQQ 287
            ..|  :..|......:..|:|      :|..:|:.  :.:|:|..::.|.|::   :...::|.:
Yeast   127 SRL--KTDEDRAVVKKMVEQTGHIDKFKKFGQLDFIDNNIVVKTDDEKEIFDQIVVRDMTLKTLE 189

  Fly   288 KQYQEKQKLML 298
            ...||.|::.|
Yeast   190 DDLQEVQEISL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17440NP_572555.1 PHD_Cfp1 40..85 CDD:277028 18/44 (41%)
zf-CpG_bind_C 231..>278 CDD:289071 10/54 (19%)
SPP1NP_015187.1 PHD_SPP1 24..69 CDD:277186 18/44 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I2586
eggNOG 1 0.900 - - E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003492
OrthoInspector 1 1.000 - - oto99955
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.