DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17440 and AL1

DIOPT Version :10

Sequence 1:NP_572555.1 Gene:CG17440 / 31879 FlyBaseID:FBgn0030120 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_196180.1 Gene:AL1 / 830444 AraportID:AT5G05610 Length:241 Species:Arabidopsis thaliana


Alignment Length:96 Identity:32/96 - (33%)
Similarity:43/96 - (44%) Gaps:22/96 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DNDKKTEEEIRREIAREFDLPERKSKIATIL-----KQKDREY--CICRSSDC------SRFMIG 54
            |...|:...::|.|       |.::|....|     :.:|.|:  .:|.|  |      ..|.|.
plant   148 DLGSKSRNGVKRSI-------EGQTKSTPKLMEESYEDEDDEHGDTLCGS--CGGNYTNDEFWIC 203

  Fly    55 CDGCEEWYHGDCIEITEKDAEHIKNYYCRRC 85
            ||.||.||||.|::||...||.||.|.|..|
plant   204 CDVCERWYHGKCVKITPAKAESIKQYKCPSC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17440NP_572555.1 PHD_Cfp1 40..85 CDD:277028 22/52 (42%)
CpG_bind_C 228..>278 CDD:463514
AL1NP_196180.1 Alfin 11..136 CDD:463480
PHD_AL_plant 187..237 CDD:277085 23/50 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.