DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17440 and KDM7A

DIOPT Version :9

Sequence 1:NP_572555.1 Gene:CG17440 / 31879 FlyBaseID:FBgn0030120 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_085150.1 Gene:KDM7A / 80853 HGNCID:22224 Length:941 Species:Homo sapiens


Alignment Length:152 Identity:36/152 - (23%)
Similarity:52/152 - (34%) Gaps:64/152 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YCICRSS-DCSRFMIGCDGCEEWYHGDCIEITEKDAEHIKNYYCRRCKKENPELQTIFRLVATER 103
            ||:||.. |.:||||.||.|::|:||.|:.:.|..|..|..|:|..|                  
Human    39 YCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNC------------------ 85

  Fly   104 AAASNAASTSLNAPGVGPSGAAPAAAPVAPATTSQQAPPPTTAAAKRKNSSAQEPKE----SQPT 164
             |..:.:|                                  ...||:|....:..|    |:|.
Human    86 -AVLHGSS----------------------------------LMKKRRNWHRHDYTEIDDGSKPV 115

  Fly   165 QAGTK------RDKAAPKTSNV 180
            ||||:      |.:..|....:
Human   116 QAGTRTFIKELRSRVFPSADEI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17440NP_572555.1 PHD_Cfp1 40..85 CDD:277028 21/45 (47%)
zf-CpG_bind_C 231..>278 CDD:289071
KDM7ANP_085150.1 PHD_KDM7 39..88 CDD:277110 23/67 (34%)
Linker 97..114 4/16 (25%)
JmjC 234..297 CDD:214721
cupin_like 269..369 CDD:304367
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 597..633
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 677..700
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 819..921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.