DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17440 and cxxc1b

DIOPT Version :9

Sequence 1:NP_572555.1 Gene:CG17440 / 31879 FlyBaseID:FBgn0030120 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_956627.1 Gene:cxxc1b / 360150 ZFINID:ZDB-GENE-030728-4 Length:563 Species:Danio rerio


Alignment Length:393 Identity:90/393 - (22%)
Similarity:143/393 - (36%) Gaps:147/393 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YCICRSSDCSRFMIGCDGCEEWYHGDCIEITEKDAEHIKNYYCRRCKKENPELQTIFRLVATERA 104
            |||||.||.:.||||||.|.||:||.||.:|||.|:.|:.:||::|:..:|.|...:|....::.
Zfish    27 YCICRKSDINCFMIGCDNCNEWFHGHCINVTEKMAKAIREWYCQQCRARDPSLSIRYRKKNRDKD 91

  Fly   105 AASNAASTSLNAP--------GVGPSGAAPAAAPVAPATTSQQ---------------------- 139
            ..........:.|        |.....:|.......|.|.::.                      
Zfish    92 VEPERVEKRSSTPEYKIDKRRGSKVKRSARMCGECEPCTRTEDCGHCDFCKDMKKFGGPNKIRQK 156

  Fly   140 ----------------------------------------------------------------- 139
                                                                             
Zfish   157 CRLRQCVVRARKMLRVRDEEFSLRERKDNIMHRDRRYSDDYDENDMDLYEHYKDRNASWGSEDDD 221

  Fly   140 ----APPPTTAA-----AKRKNSSAQEPKESQPTQAGTKRDKAAPK-TSNVQVSPRAVSPEIFLN 194
                :|.|...|     .||::....:.|||       :|.|...| ...::.|.|.        
Zfish   222 GQLYSPVPRKKAIKVKHVKRRDKKFDKKKES-------RRHKQKQKHRDRLRHSDRT-------- 271

  Fly   195 PELQG-----IQQCHGPNCCSHARPQSKYCSDECGSNLAIERLFQILPQQMQEWNITPSRAAEET 254
               .|     .|||.||||...|||.|||||::||..||..|::::|||::|:|..:|..|.|:.
Zfish   272 ---DGRHGGDTQQCLGPNCIEPARPNSKYCSEDCGMKLAANRIYEVLPQRIQQWQQSPCIAEEQG 333

  Fly   255 RKHLELNMDELVLKQQEQLEEFEKQRQQIQTQQKQYQE--------KQKLMLQQQPQQQQQQQEL 311
            :|.||.      :::::|     ..|.::...::::.|        ||:|:||.:...:...::.
Zfish   334 KKQLER------IRREQQ-----AARMRLAEMERRFHELEGIIAKAKQQLVLQDEDVNETDSEDT 387

  Fly   312 QQQ 314
            ..|
Zfish   388 DLQ 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17440NP_572555.1 PHD_Cfp1 40..85 CDD:277028 27/44 (61%)
zf-CpG_bind_C 231..>278 CDD:289071 13/46 (28%)
cxxc1bNP_956627.1 PHD_Cfp1 27..72 CDD:277028 27/44 (61%)
zf-CXXC 115..162 CDD:251032 3/46 (7%)
zf-CpG_bind_C 309..543 CDD:289071 21/93 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576616
Domainoid 1 1.000 79 1.000 Domainoid score I8604
eggNOG 1 0.900 - - E1_KOG1632
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D351589at33208
OrthoFinder 1 1.000 - - FOG0003492
OrthoInspector 1 1.000 - - mtm6560
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3950
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.