DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17440 and CG3347

DIOPT Version :9

Sequence 1:NP_572555.1 Gene:CG17440 / 31879 FlyBaseID:FBgn0030120 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001285579.1 Gene:CG3347 / 33538 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster


Alignment Length:376 Identity:89/376 - (23%)
Similarity:144/376 - (38%) Gaps:98/376 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TILKQKDREYCICRSSDCSRFMIGCDGCEEWYHGDCIEITEKDAEHIKNYYCRRCKKENPELQTI 95
            |.:..|| .|||||.|..:.|||.||.|.||:|||||.:.....|....|||..|.::||.|:..
  Fly    15 TAVSSKD-VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCT 78

  Fly    96 FRLVATERAAASNAASTSLNAPGVGPSGAAPAA--APVAPAT--TSQQAPPPTTAA--------- 147
            ::          .:.||:    ||..:...|..  .|..|.|  |.:.:..|.||.         
  Fly    79 YK----------KSPSTT----GVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQ 129

  Fly   148 -AKRKNSSAQE-PKE-SQPTQAGTKRDKAA-------------------PKTSNVQVSPR----- 185
             .:|:::..|| |.| ..|::..||..||.                   ||.:..:.:|:     
  Fly   130 NPRRRSTFVQERPSEVPNPSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPKPEDKV 194

  Fly   186 ---AVSPEIFLNPELQGIQ--------------------QCHGPNCCSHARPQSKYCSDECGSNL 227
               |..|.:....|.:|.|                    .|....|...||..|:||.||||:..
  Fly   195 TDDAQKPAVEKLFESKGTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNFT 259

  Fly   228 AIERLFQILPQQMQEWNITPSRAAEETRK-HLELNMDELVLKQQEQLEEFEKQRQQIQTQQKQYQ 291
            ||..:|.:        .:.|:..|.:... |:.|.:...:...|:..:..|....:.:|:.|..:
  Fly   260 AITNVFAL--------GLLPNMPAMKVAMGHVGLLLGNDLTNNQKSNKNSEASESKTETKPKVKK 316

  Fly   292 EKQK----------LMLQQQPQ-QQQQQQELQQQQELQQQQEQEQQQLLQQ 331
            .|.:          ..|::.|. .:...:..:.|:||.....:..::|:::
  Fly   317 PKSEGRKSRYRSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVEE 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17440NP_572555.1 PHD_Cfp1 40..85 CDD:277028 23/44 (52%)
zf-CpG_bind_C 231..>278 CDD:289071 6/47 (13%)
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 23/44 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I2586
eggNOG 1 0.900 - - E1_KOG1632
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.