Sequence 1: | NP_572555.1 | Gene: | CG17440 / 31879 | FlyBaseID: | FBgn0030120 | Length: | 366 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001095124.1 | Gene: | CXXC1 / 30827 | HGNCID: | 24343 | Length: | 660 | Species: | Homo sapiens |
Alignment Length: | 466 | Identity: | 100/466 - (21%) |
---|---|---|---|
Similarity: | 164/466 - (35%) | Gaps: | 213/466 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 YCICRSSDCSRFMIGCDGCEEWYHGDCIEITEKDAEHIKNYYCRRCKKENPELQTIFRLVAT--- 101
Fly 102 --------------------------ERAAASNAASTSLNAPG-VGPSGAAP------------- 126
Fly 127 ----------------------------------------------------------------A 127
Fly 128 AAPVAPATT---------SQQAPPPTTAAAKRK-------NSSAQEPKESQPTQ----------- 165
Fly 166 --------AGTKRDKAAPKTSNVQVSPRAVSPEIFLNPELQ------------------------ 198
Fly 199 -----------------------------GIQQCHGPNCCSHARPQSKYCSDECGSNLAIERLFQ 234
Fly 235 ILPQQMQEWNITPSRAAEETRKHLELNMDELVLKQQEQLEEFEKQRQQIQTQQKQYQEKQKLMLQ 299
Fly 300 QQPQQQQQQQE 310 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17440 | NP_572555.1 | PHD_Cfp1 | 40..85 | CDD:277028 | 29/44 (66%) |
zf-CpG_bind_C | 231..>278 | CDD:289071 | 14/46 (30%) | ||
CXXC1 | NP_001095124.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | ||
PHD_Cfp1 | 28..73 | CDD:277028 | 29/44 (66%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 84..162 | 8/77 (10%) | |||
zf-CXXC | 162..208 | CDD:366873 | 0/45 (0%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 219..287 | 12/67 (18%) | |||
zf-CpG_bind_C | 406..640 | CDD:403474 | 20/81 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 81 | 1.000 | Domainoid score | I8519 |
eggNOG | 1 | 0.900 | - | - | E1_KOG1632 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D351589at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0003492 | |
OrthoInspector | 1 | 1.000 | - | - | otm41409 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR46174 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X3950 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
10 | 9.880 |