DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17440 and CXXC1

DIOPT Version :9

Sequence 1:NP_572555.1 Gene:CG17440 / 31879 FlyBaseID:FBgn0030120 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001095124.1 Gene:CXXC1 / 30827 HGNCID:24343 Length:660 Species:Homo sapiens


Alignment Length:466 Identity:100/466 - (21%)
Similarity:164/466 - (35%) Gaps:213/466 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YCICRSSDCSRFMIGCDGCEEWYHGDCIEITEKDAEHIKNYYCRRCKKENPELQTIFRLVAT--- 101
            |||||..|.:.||||||.|.||:|||||.||||.|:.|:.:|||.|::::|:|:..:|...:   
Human    28 YCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYRHKKSRER 92

  Fly   102 --------------------------ERAAASNAASTSLNAPG-VGPSGAAP------------- 126
                                      :|.|.|.....::.|.| ..|..::|             
Human    93 DGNERDSSEPRDEGGGRKRPVPDPDLQRRAGSGTGVGAMLARGSASPHKSSPQPLVATPSQHHQQ 157

  Fly   127 ----------------------------------------------------------------A 127
                                                                            :
Human   158 QQQQIKRSARMCGECEACRRTEDCGHCDFCRDMKKFGGPNKIRQKCRLRQCQLRARESYKYFPSS 222

  Fly   128 AAPVAPATT---------SQQAPPPTTAAAKRK-------NSSAQEPKESQPTQ----------- 165
            .:||.|:.:         :||.|.|:....:.:       :|:.:||.|:..|.           
Human   223 LSPVTPSESLPRPRRPLPTQQQPQPSQKLGRIREDEGAVASSTVKEPPEATATPEPLSDEDLPLD 287

  Fly   166 --------AGTKRDKAAPKTSNVQVSPRAVSPEIFLNPELQ------------------------ 198
                    ||...|...|..|:.:.||       ||:|.|:                        
Human   288 PDLYQDFCAGAFDDHGLPWMSDTEESP-------FLDPALRKRAVKVKHVKRREKKSEKKVMERK 345

  Fly   199 -----------------------------GIQQCHGPNCCSHARPQSKYCSDECGSNLAIERLFQ 234
                                         .:.||.||.|...|:|.||||||:||..||..|:::
Human   346 EERYKRHRQKQKHKDKWKHPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYE 410

  Fly   235 ILPQQMQEWNITPSRAAEETRKHLELNMDELVLKQQEQLEEFEKQRQQIQTQQKQYQEKQKLMLQ 299
            ||||::|:|..:|..|.|..:|.||.      :::::|     ..|.::|..::::.|.:.::|:
Human   411 ILPQRIQQWQQSPCIAEEHGKKLLER------IRREQQ-----SARTRLQEMERRFHELEAIILR 464

  Fly   300 QQPQQQQQQQE 310
            .:.|..::.:|
Human   465 AKQQAVREDEE 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17440NP_572555.1 PHD_Cfp1 40..85 CDD:277028 29/44 (66%)
zf-CpG_bind_C 231..>278 CDD:289071 14/46 (30%)
CXXC1NP_001095124.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PHD_Cfp1 28..73 CDD:277028 29/44 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..162 8/77 (10%)
zf-CXXC 162..208 CDD:366873 0/45 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..287 12/67 (18%)
zf-CpG_bind_C 406..640 CDD:403474 20/81 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8519
eggNOG 1 0.900 - - E1_KOG1632
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D351589at33208
OrthoFinder 1 1.000 - - FOG0003492
OrthoInspector 1 1.000 - - otm41409
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3950
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.