DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17440 and BPTF

DIOPT Version :9

Sequence 1:	NP_572555.1	Gene:	CG17440 / 31879	FlyBaseID:	FBgn0030120	Length:	366	Species:	Drosophila melanogaster
Sequence 2:	XP_005257207.1	Gene:	BPTF / 2186	HGNCID:	3581	Length:	3158	Species:	Homo sapiens

Alignment Length:	102	Identity:	37/102 - (36%)
Similarity:	58/102 - (56%)	Gaps:	12/102 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 NDKKTEEEIRREIAREFDLPERKSKIATILKQKDRE---YCICRSS-DCSRFMIGCDGCEEWYHG 64
            :.|:..||.:...::.    ::|..|:|..|:..::   ||||::. |.|:|.||||.|..||||
Human  2888 SQKRKREEEKDSSSKS----KKKKMISTTSKETKKDTKLYCICKTPYDESKFYIGCDLCTNWYHG 2948

  Fly    65 DCIEITEKDAEHIKNYYCRRCKK----ENPELQTIFR 97
            :|:.||||:|:.:..|.|..||:    .:.||..|.|
Human  2949 ECVGITEKEAKKMDVYICNDCKRAQEGSSEELYCICR 2985

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17440	NP_572555.1	PHD_Cfp1	40..85	CDD:277028	24/45 (53%)
CG17440	NP_572555.1	zf-CpG_bind_C	231..>278	CDD:289071
BPTF	XP_005257207.1	DDT	241..297	CDD:280886
		WHIM1	339..388	CDD:292246
		PHD1_BPTF	392..434	CDD:277034
		Med15	2217..>2598	CDD:255446
		TNG2	2742..2972	CDD:227367	33/87 (38%)
		PHD2_3_BPTF	2923..2969	CDD:277035	24/45 (53%)
		PHD2_3_BPTF	2981..3027	CDD:277035	2/5 (40%)
		Bromo_gcn5_like	3043..3143	CDD:99941
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1632
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900