DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17440 and cfp-1

DIOPT Version :9

Sequence 1:NP_572555.1 Gene:CG17440 / 31879 FlyBaseID:FBgn0030120 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001379228.1 Gene:cfp-1 / 178363 WormBaseID:WBGene00009924 Length:508 Species:Caenorhabditis elegans


Alignment Length:252 Identity:63/252 - (25%)
Similarity:105/252 - (41%) Gaps:72/252 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KNYYCRRCKKENPE-LQTIFRLVATERAAASNAASTSLNAPGVGPSGAAPAAAPVAPATTSQQAP 141
            |..|..:.|::..| |:.|....| :|.||..||:|:               ||.||....||..
 Worm    50 KRLYNEKVKRQTDENLKAIMAKTA-QREAAHQAATTT---------------APSAPVVIEQQVE 98

  Fly   142 PP------------TTAAAKRKNSSAQEPKESQPTQAGTKRDKAAPKTSNVQVSPRAVSPEIFLN 194
            ..            ..|||:::.::....::..|.:. |::..|..:....|::   ..|:  .:
 Worm    99 KKKRGRKKGSGNGGAAAAAQQRKANIINERDYVPNRP-TRQQSADLRRKRTQLN---AEPD--KH 157

  Fly   195 PELQGIQQCHGPNCCSHARPQSKYCSDECGSNLAIERLFQILPQQMQEW--------------NI 245
            |     :||..|||...:|..|||||||||..||..||.:|||.:.:::              .|
 Worm   158 P-----RQCLNPNCIYESRIDSKYCSDECGKELARMRLTEILPNRCKQYFFEGPSGGPRSLEDEI 217

  Fly   246 TPSRA--------AEETRKHLELNMDELVLKQQEQLEEFEKQRQQIQT--QQKQYQE 292
            .|.||        ..|:.|::...:::||        ||.|.:.::|.  .:::|.:
 Worm   218 KPKRAKINREVQKLTESEKNMMAFLNKLV--------EFIKTQLKLQPLGTEERYDD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17440NP_572555.1 PHD_Cfp1 40..85 CDD:277028 2/6 (33%)
zf-CpG_bind_C 231..>278 CDD:289071 15/68 (22%)
cfp-1NP_001379228.1 zf-CpG_bind_C 188..435 CDD:403474 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003492
OrthoInspector 1 1.000 - - otm14440
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3950
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.