DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17440 and si:ch73-181d5.4

DIOPT Version :9

Sequence 1:NP_572555.1 Gene:CG17440 / 31879 FlyBaseID:FBgn0030120 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_003201203.2 Gene:si:ch73-181d5.4 / 100538306 ZFINID:ZDB-GENE-100922-118 Length:2142 Species:Danio rerio


Alignment Length:283 Identity:57/283 - (20%)
Similarity:97/283 - (34%) Gaps:98/283 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QKDREYCIC----RSSDCSRFMIGCDGCEEWYHGDCIEITE--KDAEHIKNYYCRRCKKENPELQ 93
            ::|.:..:|    :..|.:|..|.|..|..:.|.||:.|.|  |:.|    |.|..| .||.|| 
Zfish   201 EEDNQDAVCGTCGQRDDSNRLTISCKSCGAFRHVDCVGIFETWKNEE----YMCPPC-TENREL- 259

  Fly    94 TIFRLVATERAAASNAASTSLNAPGVGPSGAAPAAAPVAPATTSQQAPPPTTAAAKRKNSSAQEP 158
                                                    ...:|:...|   ..|::.||....
Zfish   260 ----------------------------------------TCRNQKTDDP---CLKQEISSINMV 281

  Fly   159 KESQPTQAGTKRDKAAPKTSNVQVSPRAVSPEIFLNPELQGIQQCHGPNCCSHARPQSKYCSDEC 223
            ...|..:.         :.:.|:|||:                 |.||.|.|.|.|:|.||...|
Zfish   282 DVQQMIKV---------EQNVVEVSPK-----------------CIGPGCSSDALPESVYCGHRC 320

  Fly   224 ---GSNLAIERLFQILPQQMQEWNITPSRAAEE---TRKHLELNMDELVLKQQEQLEEFEKQRQQ 282
               .:.:||:.|.:..|:....  :.||..:|:   ..|..::.:::...:::::.:..||..:.
Zfish   321 IVQHAAVAIKTLSEPKPEVKSA--VVPSLKSEKRSFLAKLFKVKVNKSPAEREQEGKAEEKSEES 383

  Fly   283 I---------QTQQKQYQEKQKL 296
            :         ||......|..||
Zfish   384 VCSSAVADPAQTTTATPPEHHKL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17440NP_572555.1 PHD_Cfp1 40..85 CDD:277028 15/50 (30%)
zf-CpG_bind_C 231..>278 CDD:289071 6/49 (12%)
si:ch73-181d5.4XP_003201203.2 PHD_SHPRH 211..253 CDD:277022 14/45 (31%)
TFIIS_M 626..717 CDD:284835
PHA03255 820..>963 CDD:165513
SPOC 983..1089 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.