DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31533 and KRT20

DIOPT Version :10

Sequence 1:NP_731887.1 Gene:CG31533 / 318788 FlyBaseID:FBgn0051533 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_061883.1 Gene:KRT20 / 54474 HGNCID:20412 Length:424 Species:Homo sapiens


Alignment Length:185 Identity:40/185 - (21%)
Similarity:61/185 - (32%) Gaps:56/185 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 SWMPKYAPCPQCNTKAVPILQGHPIENITAEEILAEQLVKPKAPPGVEDFCE--PPCEKVRRKIW 392
            |::.|.....|.|:|.               |:..:|..:..||....|:..  ...|::|.:| 
Human    83 SYLEKVRTLEQSNSKL---------------EVQIKQWYETNAPRAGRDYSAYYRQIEELRSQI- 131

  Fly   393 NDTECPPCRCTCSKGNTCPHCRIRKMCDDIFTAKSPPKPPRRIPKPRSSEDFCVVMESEG----- 452
            .|.:....||.....|                ||            .::|||.:..|:|.     
Human   132 KDAQLQNARCVLQIDN----------------AK------------LAAEDFRLKYETERGIRLT 168

  Fly   453 -EDDLPYLAKVFSELKNLYHIHDTKKLSAIKERCASQSLFTIRSRRSIKELTKSL 506
             |.||..|.|||.:|.    :|.|.....|:|.....:|.....:..:..|.|.|
Human   169 VEADLQGLNKVFDDLT----LHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31533NP_731887.1 DUF4788 12..260 CDD:406440
DUF4776 315..758 CDD:406413 40/185 (22%)
KRT20NP_061883.1 Head 1..69
Filament 69..380 CDD:459643 40/185 (22%)
Coil 1A 70..105 6/36 (17%)
Linker 1 106..123 3/16 (19%)
Coil 1B 124..215 27/123 (22%)
Linker 12 216..238 2/4 (50%)
Coil 2 239..377
Tail 378..424
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.