DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31533 and CG3199

DIOPT Version :10

Sequence 1:NP_731887.1 Gene:CG31533 / 318788 FlyBaseID:FBgn0051533 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster


Alignment Length:199 Identity:51/199 - (25%)
Similarity:83/199 - (41%) Gaps:25/199 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLFDLVITNLNIFGVTIDEPAKLLVETKVAGKSVKVTSSRINVDQFVAGREFELPMEASTLRQSL 71
            |.||||||.|.:.||.:.:..||||:.|..|.::.:|:||.||.:|..........|...|.|::
  Fly    40 FSFDLVITRLEVKGVVLADARKLLVKVKFGGNNLSLTASRTNVSEFKPNASHTFQAEPPNLAQTV 104

  Fly    72 EEKGLTLAGVYQGSTLGKATGNFPVEFLDKISPTMNDLVHEDTLDLVRRVDVVGTVSVLIRLTVK 136
            ||.|:....||....:|....:.|.....:|...|....:..|..|......||.:..|.:|.:|
  Fly   105 EENGIDFEVVYDEQVVGLGKLSLPKRLSTRIKLDMKAFSYTSTCPLEMEGKPVGALEFLCKLFIK 169

  Fly   137 CEEHPEQKPSRQSLSRTSKSSMILPKKEKSGRVSCASQGPTFNPQDVMFLIGDPDPLLRIPSEPC 201
            |.::..:..:..:|.|                        ..:|:|::|::|........ .:||
  Fly   170 CGDYAREGETCPNLDR------------------------NLSPRDIVFVVGKSQANTSC-CDPC 209

  Fly   202 SELL 205
            .:.|
  Fly   210 RDAL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31533NP_731887.1 DUF4788 12..260 CDD:406440 47/194 (24%)
DUF4776 315..758 CDD:406413
CG3199NP_650342.2 DUF4788 45..>216 CDD:406440 47/194 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.