DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31533 and KRT34

DIOPT Version :10

Sequence 1:NP_731887.1 Gene:CG31533 / 318788 FlyBaseID:FBgn0051533 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_011523095.1 Gene:KRT34 / 3885 HGNCID:6452 Length:412 Species:Homo sapiens


Alignment Length:37 Identity:12/37 - (32%)
Similarity:15/37 - (40%) Gaps:14/37 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 EDFCEPPCEKVRRKIWNDTECPPCRCTCSKGNTCPHC 413
            || |:.||.             ||..|.:.||:|..|
Human   381 ED-CKLPCN-------------PCATTNASGNSCGPC 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31533NP_731887.1 DUF4788 12..260 CDD:406440
DUF4776 315..758 CDD:406413 12/37 (32%)
KRT34XP_011523095.1 Filament 73..384 CDD:459643 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.