powered by:
Protein Alignment CG31533 and KRT34
DIOPT Version :10
| Alignment Length: | 37 |
Identity: | 12/37 - (32%) |
| Similarity: | 15/37 - (40%) |
Gaps: | 14/37 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 377 EDFCEPPCEKVRRKIWNDTECPPCRCTCSKGNTCPHC 413
|| |:.||. ||..|.:.||:|..|
Human 381 ED-CKLPCN-------------PCATTNASGNSCGPC 403
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG31533 | NP_731887.1 |
DUF4788 |
12..260 |
CDD:406440 |
|
| DUF4776 |
315..758 |
CDD:406413 |
12/37 (32%) |
| KRT34 | XP_011523095.1 |
Filament |
73..384 |
CDD:459643 |
2/3 (67%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.