DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31533 and KRT19

DIOPT Version :10

Sequence 1:NP_731887.1 Gene:CG31533 / 318788 FlyBaseID:FBgn0051533 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_002267.2 Gene:KRT19 / 3880 HGNCID:6436 Length:400 Species:Homo sapiens


Alignment Length:113 Identity:28/113 - (24%)
Similarity:46/113 - (40%) Gaps:19/113 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IFGVTIDEPAKLLVETKVAGKSVKVTSSRINVDQFVAGREFELPMEASTLRQSLEEKGLTLAGVY 82
            |.|.||:....:|          ::.::|:..|.|....|.|     ..||.|:|.....|..|.
Human   141 ILGATIENSRIVL----------QIDNARLAADDFRTKFETE-----QALRMSVEADINGLRRVL 190

  Fly    83 QGSTLGKATGNFPVEFL-DKISPTMNDLVHEDTLDLVRRVDVVGTVSV 129
            ...||.:......:|.| ::::....:  ||:.:..:|. .|.|.|||
Human   191 DELTLARTDLEMQIEGLKEELAYLKKN--HEEEISTLRG-QVGGQVSV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31533NP_731887.1 DUF4788 12..260 CDD:406440 28/113 (25%)
DUF4776 315..758 CDD:406413
KRT19NP_002267.2 Head 1..79
Filament 79..390 CDD:459643 28/113 (25%)
Coil 1A 80..115
Linker 1 116..133
Coil 1B 134..225 22/100 (22%)
Linker 12 226..248 6/11 (55%)
Necessary for interaction with PNN. /evidence=ECO:0000269|PubMed:10809736 244..390
Coil 2 249..387
Rod-like helical tail 388..400
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.