DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31533 and KRT10

DIOPT Version :10

Sequence 1:NP_731887.1 Gene:CG31533 / 318788 FlyBaseID:FBgn0051533 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001366295.1 Gene:KRT10 / 3858 HGNCID:6413 Length:624 Species:Homo sapiens


Alignment Length:111 Identity:31/111 - (27%)
Similarity:51/111 - (45%) Gaps:11/111 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TIDEPAK--LLVETKVAGKSVKVTSSRINVDQFVAGREFELPMEASTLRQSLEEKGLTLAGVYQG 84
            |||:...  |.:.|..|...:::.::|:..|.|....|.|:     .||||:|.....|..|...
Human   202 TIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYENEV-----ALRQSVEADINGLRRVLDE 261

  Fly    85 STLGKATGNFPVEFL-DKISPTMNDLVHEDTLDLVRRVDVVGTVSV 129
            .||.||.....:|.| ::::....:  ||:.:..:|.|. .|.|:|
Human   262 LTLTKADLEMQIESLTEELAYLKKN--HEEEMKDLRNVS-TGDVNV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31533NP_731887.1 DUF4788 12..260 CDD:406440 31/111 (28%)
DUF4776 315..758 CDD:406413
KRT10NP_001366295.1 Head 1..145
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Filament 145..454 CDD:459643 31/111 (28%)
Coil 1A 146..181
Linker 1 182..202 31/111 (28%)
Coil 1B 203..294 25/97 (26%)
Linker 12 295..317 5/11 (45%)
Coil 2 318..456
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.