DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31533 and Krt19

DIOPT Version :10

Sequence 1:NP_731887.1 Gene:CG31533 / 318788 FlyBaseID:FBgn0051533 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_032497.1 Gene:Krt19 / 16669 MGIID:96693 Length:403 Species:Mus musculus


Alignment Length:213 Identity:45/213 - (21%)
Similarity:83/213 - (38%) Gaps:42/213 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IFGVTIDEPAKLLVETKVAGKSVKVTSSRINVDQFVAGREFELPMEASTLRQSLEEKGLTLAGVY 82
            |.|.|||. :|::::         :.::|:..|.|....|.|     ..||.|:|.....|..|.
Mouse   144 ILGATIDN-SKIVLQ---------IDNARLAADDFRTKFETE-----HALRLSVEADINGLRRVL 193

  Fly    83 QGSTLGKATGNFPVEFL-DKISPTMNDLVHEDTLDLVRRVDVVGTVSVLIRLTVKCEEHPEQKPS 146
            ...||.:......:|.| ::::....:  ||:.:..:|. .|.|.|||.:..|      |....:
Mouse   194 DELTLARTDLEMQIESLKEELAYLKKN--HEEEITALRS-QVGGQVSVEVDST------PGVDLA 249

  Fly   147 RQSLSRTSKSSMILPKKEKSGRVSCASQGPTFNPQDVMFLIGDPDPLLRIPSEPCSELLSEIGDE 211
            :......|:..::..|..|....:..::....|.|            :.:.||......:|:.|.
Mouse   250 KILSEMRSQYEIMAEKNRKDAEATYLARIEELNTQ------------VAVHSEQIQISKTEVTDL 302

  Fly   212 R-----LKLDLQRYKSLE 224
            |     |:::||...|::
Mouse   303 RRTLQGLEIELQSQLSMK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31533NP_731887.1 DUF4788 12..260 CDD:406440 45/213 (21%)
DUF4776 315..758 CDD:406413
Krt19NP_032497.1 Head 1..82
Filament 82..393 CDD:459643 45/213 (21%)
Coil 1A 83..118
Linker 1 119..136
Coil 1B 137..228 23/100 (23%)
Linker 12 229..251 8/28 (29%)
Necessary for interaction with PNN. /evidence=ECO:0000250 247..393 14/86 (16%)
Coil 2 252..390 14/81 (17%)
Rod-like helical tail 391..403
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.