DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31528 and OASL

DIOPT Version :10

Sequence 1:NP_730833.1 Gene:CG31528 / 318785 FlyBaseID:FBgn0051528 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_003724.1 Gene:OASL / 8638 HGNCID:8090 Length:514 Species:Homo sapiens


Alignment Length:142 Identity:34/142 - (23%)
Similarity:55/142 - (38%) Gaps:30/142 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GSGRVETVTLRQNELIRNLRVL----VAVRFEQAISRII--LVFAGQVLSDEG------------ 59
            |:|.|...| |:.||:..|...    .|.:..:.:.|:|  .::..|.|.|.|            
Human    71 GNGTVLRST-REVELVAFLSCFHSFQEAAKHHKDVLRLIWKTMWQSQDLLDLGLEDLRMEQRVPD 134

  Fly    60 ----TIDSRGIVSGVTVHVV--CRAEAANSPSPTP-----IAATKRSKPSERLMRSWQSAHIAFL 113
                ||.:||....:||.:|  .||...:.|:..|     ::..|..........|:......|:
Human   135 ALVFTIQTRGTAEPITVTIVPAYRALGPSLPNSQPPPEVYVSLIKACGGPGNFCPSFSELQRNFV 199

  Fly   114 QQEPDVLRSLLQ 125
            :..|..|:|||:
Human   200 KHRPTKLKSLLR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31528NP_730833.1 Ubl1_cv_Nsp3_N-like 7..77 CDD:475130 22/87 (25%)
UBA_like_SF 299..335 CDD:473871
OASLNP_003724.1 NT_2-5OAS_ClassI-CCAase 29..212 CDD:143390 34/142 (24%)
OAS1_C 167..351 CDD:463087 9/45 (20%)
Ubl1_OASL 354..427 CDD:340509
Ubl2_OASL 433..504 CDD:340520
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.