DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31528 and AT5G09340

DIOPT Version :10

Sequence 1:NP_730833.1 Gene:CG31528 / 318785 FlyBaseID:FBgn0051528 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_196496.1 Gene:AT5G09340 / 830793 AraportID:AT5G09340 Length:79 Species:Arabidopsis thaliana


Alignment Length:52 Identity:9/52 - (17%)
Similarity:22/52 - (42%) Gaps:9/52 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GRVETVTLRQNELIRNLRVLV--------AVRFEQAISRIIL-VFAGQVLSD 57
            |:...|.:.:...|.:::..:        |.::.:...:|:| |..|..:.|
plant    10 GKKYCVEVEKTTTIADMKTKIYDATGMENAYQYLEHRGKIVLEVHGGTTMDD 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31528NP_730833.1 Ubl1_cv_Nsp3_N-like 7..77 CDD:475130 9/52 (17%)
UBA_like_SF 299..335 CDD:473871
AT5G09340NP_196496.1 Ubl_ubiquitin_like 3..72 CDD:340559 9/52 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.