DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31528 and Nedd8

DIOPT Version :10

Sequence 1:NP_730833.1 Gene:CG31528 / 318785 FlyBaseID:FBgn0051528 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_609919.1 Gene:Nedd8 / 35151 FlyBaseID:FBgn0032725 Length:84 Species:Drosophila melanogaster


Alignment Length:36 Identity:9/36 - (25%)
Similarity:19/36 - (52%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LVFAGQVLSDEGTIDSRGIVSGVTVHVVCRAEAANS 83
            |:|:|:.::|:.|.....:..|..:|:|......:|
  Fly    43 LIFSGKQMNDDKTAADYKVQGGSVLHLVLALRGGDS 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31528NP_730833.1 Ubl1_cv_Nsp3_N-like 7..77 CDD:475130 8/28 (29%)
UBA_like_SF 299..335 CDD:473871
Nedd8NP_609919.1 Ubl_NEDD8 3..76 CDD:340504 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.