DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31528 and Fau

DIOPT Version :10

Sequence 1:NP_730833.1 Gene:CG31528 / 318785 FlyBaseID:FBgn0051528 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_063144026.1 Gene:Fau / 29752 RGDID:61938 Length:188 Species:Rattus norvegicus


Alignment Length:82 Identity:19/82 - (23%)
Similarity:32/82 - (39%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VETVTLRQNELIRNLRVLVAVRFEQAISRIILVFAGQVLSDEGTIDSRGIVSGVTVHVVCR---- 77
            :.|:.:...|.:..::..||.....|....:::.||..|.||.|:...|:.:..|:.|..|    
  Rat    10 LHTLEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG 74

  Fly    78 ------AEAANSPSPTP 88
                  |.|......||
  Rat    75 KVHGSLARAGKVRGQTP 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31528NP_730833.1 Ubl1_cv_Nsp3_N-like 7..77 CDD:475130 14/59 (24%)
UBA_like_SF 299..335 CDD:473871
FauXP_063144026.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.