DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31528 and Ubd

DIOPT Version :10

Sequence 1:NP_730833.1 Gene:CG31528 / 318785 FlyBaseID:FBgn0051528 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_075626.1 Gene:Ubd / 24108 MGIID:1344410 Length:162 Species:Mus musculus


Alignment Length:147 Identity:27/147 - (18%)
Similarity:62/147 - (42%) Gaps:13/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SIDICAKGSG--RVETVTLRQNELIRNLRVLVAVRFEQAISRIILVFAGQVLSDEGTIDSRGIVS 68
            |:..|...|.  |:.|....:|:.::.:...:..:.:.::...||:...::|.....:.|.||..
Mouse     3 SVRTCVVRSDQWRLMTFETTENDKVKKINEHIRSQTKVSVQDQILLLDSKILKPHRKLSSYGIDK 67

  Fly    69 GVTVHVVCRAEAANSPSPTPIAATKRSKPSER-LMRSWQSAHIAFLQQEPDVLRSLLQADPRIRS 132
            ..|:|:..:. ...|....|:...:.....:| |:|..:|:.:|   |..:::.|:....|:.:.
Mouse    68 ETTIHLTLKV-VKPSDEELPLFLVESKNEGQRHLLRVRRSSSVA---QVKEMIESVTSVIPKKQV 128

  Fly   133 L------LDENAAMRHY 143
            :      |::...|..|
Mouse   129 VNCNGKKLEDGKIMADY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31528NP_730833.1 Ubl1_cv_Nsp3_N-like 7..77 CDD:475130 13/71 (18%)
UBA_like_SF 299..335 CDD:473871
UbdNP_075626.1 Ubl1_cv_Nsp3_N-like 9..79 CDD:475130 12/70 (17%)
Ubl1_cv_Nsp3_N-like 87..156 CDD:475130 11/62 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.