DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31524 and AT1G20270

DIOPT Version :9

Sequence 1:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:259 Identity:68/259 - (26%)
Similarity:118/259 - (45%) Gaps:39/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 SEPIREEPNDDIEEMELPPCCSGRCEGPRKLNRLYCVYNCVTAPFLRLAPIKTEILSVDPFVILL 333
            |.||..:.:..|:........:.|.||..|....:                 ||:||.:|...:.
plant    41 SLPINNDESSPIDLSYFRRAATERSEGLGKRGDQW-----------------TEVLSWEPRAFVY 88

  Fly   334 HDMVSHKEGALIRSSSKNQILPSETVNA-ANEFEIAKFRTSKSVWFDSDANEATLKLTQRLGEAT 397
            |:.:|.:|...:.|.:|..::.|..|:: ..:.:.::.|||...:.....::....:.:|:.:.|
plant    89 HNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYT 153

  Fly   398 GLDMKHSEPFQVINYGIGGVFESHFDTSLADEDRFVNGYIDRLATTLFYLNDVPQGGATHFPGLN 462
            .:...|.|..||::|..|..:|.|:| ...||....||. .|:||.|.||:||.:||.|.||..|
plant   154 FIPADHGEGLQVLHYEAGQKYEPHYD-YFVDEFNTKNGG-QRMATMLMYLSDVEEGGETVFPAAN 216

  Fly   463 -------------------ITVFPKFGTVLMWYNLHTEGMLHVRTMHTGCPVIVGSKWVVSKWI 507
                               ::|.|:.|..|:::::..:..|...::|.|||||.|:||..:||:
plant   217 MNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTSLHGGCPVIRGNKWSSTKWM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528
TPR_11 215..>259 CDD:290150
TPR_2 216..249 CDD:285020
P4Hc 340..507 CDD:214780 52/186 (28%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 58/204 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.