DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31524 and AT5G18900

DIOPT Version :9

Sequence 1:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 / 832008 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana


Alignment Length:193 Identity:56/193 - (29%)
Similarity:89/193 - (46%) Gaps:31/193 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 MVSHKEGALIRSSSKNQILPSETVNAANEFEIAKFRTSKSVWFDSDANEATLKLTQRLGEATGLD 400
            |||..:.:|.||:..:        |.:.|.:.::.|||...:.....:.....:..::...|.|.
plant    61 MVSLAKASLKRSAVAD--------NDSGESKFSEVRTSSGTFISKGKDPIVSGIEDKISTWTFLP 117

  Fly   401 MKHSEPFQVINYGIGGVFESHFDTSLADEDRFVNGYIDRLATTLFYLNDVPQGGATHFPGL---- 461
            .::.|..||:.|..|..:::||| ...|:...|.|. .|:||.|.||::|.:||.|.||..    
plant   118 KENGEDIQVLRYEHGQKYDAHFD-YFHDKVNIVRGG-HRMATILMYLSNVTKGGETVFPDAEIPS 180

  Fly   462 -----------------NITVFPKFGTVLMWYNLHTEGMLHVRTMHTGCPVIVGSKWVVSKWI 507
                             .|.|.|:.|..|:::|||.:.:....::|.|||||.|.||..:|||
plant   181 RRVLSENKEDLSDCAKRGIAVKPRKGDALLFFNLHPDAIPDPLSLHGGCPVIEGEKWSATKWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528
TPR_11 215..>259 CDD:290150
TPR_2 216..249 CDD:285020
P4Hc 340..507 CDD:214780 51/187 (27%)
AT5G18900NP_197391.1 PLN00052 33..298 CDD:177683 56/193 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.