DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31524 and AT4G35820

DIOPT Version :9

Sequence 1:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:289 Identity:73/289 - (25%)
Similarity:128/289 - (44%) Gaps:52/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 TLGKVRFERRNEEGALKAYQAA--LKHSPHDLEIFQEYQNLKRRVLTLSPSEPIREEPNDDIEEM 283
            ::..:.:.|:..:| ||.|:.:  ::|    :..|.|....:     :|....|.|:..|.|...
plant     6 SVSTILYLRQRLQG-LKIYETSDLIQH----INTFDELVGEQ-----VSVDVKIEEKTKDMILLC 60

  Fly   284 ELPPCCSGRCEGPRKLNRLYCVYNCVTAPFLRLAPIK-TEILSVDPFVILLHDMV--------SH 339
            .|.|.          |..|.|....|.|. ||....: .|:::.:|...:.|:.:        ::
plant    61 SLSPL----------LTTLTCSMVKVAAS-LRFPNERWLEVITKEPRAFVYHNFLALFFKICKTN 114

  Fly   340 KEGALIRSSSKNQILPSETVNAANEF-EIAKFRTSKSVWFDSDANEATLKLTQRLGEATGLDMKH 403
            :|...:.|.:|..:..|:..||.... |.:..|||...:..|..::...::.:|:.|.|.:..::
plant   115 EECDHLISLAKPSMARSKVRNALTGLGEESSSRTSSGTFIRSGHDKIVKEIEKRISEFTFIPQEN 179

  Fly   404 SEPFQVINYGIGGVFESHFDTSLADEDRFVNGYIDRLATTLFYLNDVPQGGATHFP---GL---- 461
            .|..|||||.:|..||.|||           |: .|:||.|.||:||.:||.|.||   |:    
plant   180 GETLQVINYEVGQKFEPHFD-----------GF-QRIATVLMYLSDVDKGGETVFPEAKGIKSKK 232

  Fly   462 NITVFPKFGTVLMWYNLHTEGMLHVRTMH 490
            .::|.||.|..|:::::..:|.....:.|
plant   233 GVSVRPKKGDALLFWSMRPDGSRDPSSKH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528
TPR_11 215..>259 CDD:290150 8/39 (21%)
TPR_2 216..249 CDD:285020 6/29 (21%)
P4Hc 340..507 CDD:214780 48/159 (30%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 18/90 (20%)
P4Hc 115..262 CDD:214780 48/159 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.