DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31524 and AT3G28490

DIOPT Version :9

Sequence 1:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:226 Identity:57/226 - (25%)
Similarity:102/226 - (45%) Gaps:22/226 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 LYCVYNCVTAPFLRLAPIKTEILSVDPFVILLHDMVSHKEGALIRSSSKNQILPSETVN--AANE 364
            |..:::.:::....:.|.:...||..|...|....:|.:|...:...:|.::..|..|.  .:.|
plant    13 LLLIFSQISSFSFSVDPTRITQLSWTPRAFLYKGFLSDEECDHLIKLAKGKLEKSMVVADVDSGE 77

  Fly   365 FEIAKFRTSKSVWFDSDANEATLKLTQRLGEATGLDMKHSEPFQVINYGIGGVFESHFDTSLADE 429
            .|.::.|||..::.....::....:..:|...|.|..::.|..|:::|..|..::.|||.....:
plant    78 SEDSEVRTSSGMFLTKRQDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYFYDKK 142

  Fly   430 DRFVNGYIDRLATTLFYLNDVPQGGATHFPG------------------LNITVFPKFGTVLMWY 476
            ...:.|:  |:||.|.||::|.:||.|.||.                  ....|.|:.|..|:::
plant   143 ALELGGH--RIATVLMYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFF 205

  Fly   477 NLHTEGMLHVRTMHTGCPVIVGSKWVVSKWI 507
            |||..|.....::|..||||.|.||..::||
plant   206 NLHLNGTTDPNSLHGSCPVIEGEKWSATRWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528
TPR_11 215..>259 CDD:290150
TPR_2 216..249 CDD:285020
P4Hc 340..507 CDD:214780 48/186 (26%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 56/211 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.