DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31524 and P4H13

DIOPT Version :9

Sequence 1:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:210 Identity:55/210 - (26%)
Similarity:93/210 - (44%) Gaps:32/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LSVDPFVILLHDMVSHKEGALIRSSSKNQILPS-------ETVNAANEFEIAKFRTSKSVWFDSD 381
            ||.:|.|..|.:..:.::...:...:|.::.||       ||......:......|      |.|
plant    71 LSWNPRVFYLPNFATKQQCEAVIDMAKPKLKPSTLALRKGETAETTQNYRSLHQHT------DED 129

  Fly   382 ANEATLKLTQRLGEATGLDMKHSEPFQVINYGIGGVFESHFDT-SLADEDRFVNGYIDRLATTLF 445
            .:.....:.:::..||.....:.|.|.::.|.:|..::||:|. ..|:....::   .|:.|.|.
plant   130 ESGVLAAIEEKIALATRFPKDYYESFNILRYQLGQKYDSHYDAFHSAEYGPLIS---QRVVTFLL 191

  Fly   446 YLNDVPQGGATHFP---GLN------------ITVFPKFGTVLMWYNLHTEGMLHVRTMHTGCPV 495
            :|:.|.:||.|.||   |.|            :.|.|:.|..:.:|||...|.:...::|..|||
plant   192 FLSSVEEGGETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLFPNGTIDQTSLHGSCPV 256

  Fly   496 IVGSKWVVSKWIDDK 510
            |.|.|||.:|||.|:
plant   257 IKGEKWVATKWIRDQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528
TPR_11 215..>259 CDD:290150
TPR_2 216..249 CDD:285020
P4Hc 340..507 CDD:214780 47/189 (25%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 48/192 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.