DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31524 and p4htma

DIOPT Version :9

Sequence 1:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001074160.1 Gene:p4htma / 791209 ZFINID:ZDB-GENE-070112-2222 Length:478 Species:Danio rerio


Alignment Length:264 Identity:67/264 - (25%)
Similarity:92/264 - (34%) Gaps:81/264 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 KTEILSVDPFVILLHDMVSHK-EGALIRSSSKNQILPSETVNAANEFEIAKF-RTSKSVWFDSDA 382
            :.||||           :||. :|:.:.|.:..:|......|.:....:.:| |.|..|...|.|
Zfish   200 REEILS-----------LSHSTDGSWLSSYNLRKIHTGLETNPSGVLSLQEFKRVSGGVLRYSGA 253

  Fly   383 NEAT---LKLTQR-------LGEATGLDMKH------------------SEPFQVINYGIGGVFE 419
            .:..   .|:.||       |||.|...:|.                  ||..:|:.|..|....
Zfish   254 AQGLDGHTKVRQRSTHTRLYLGEGTHHLLKSVRNRVTRLTRLPSSLVDLSEAMEVVRYEQGVFSH 318

  Fly   420 SHFDTSLADEDRFV----------NGYIDRLATTLFYLNDVPQGGATHFPGL------------- 461
            :|.|:|....|...          |....|..|.|.|||....||.|.||..             
Zfish   319 AHHDSSPTHPDNSCTHTHLAANTSNQVACRYLTVLLYLNSADSGGETSFPVADNRTYEEEVLGDL 383

  Fly   462 --------NITVFPKFGTVLMWYNLHTE-----GMLHVRTMHTGCPVIVGSKWVVSKWI----DD 509
                    |:.|.|..||.|:|||..::     |.|...::|..|.|..|.||..|.|:    |.
Zfish   384 SQQYCDKGNLKVKPVAGTALLWYNHLSDGNGWVGELDEFSLHGDCLVTRGFKWTGSVWVNIDPDQ 448

  Fly   510 KGQE 513
            :.||
Zfish   449 QRQE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528
TPR_11 215..>259 CDD:290150
TPR_2 216..249 CDD:285020
P4Hc 340..507 CDD:214780 57/232 (25%)
p4htmaNP_001074160.1 2OG-FeII_Oxy <272..442 CDD:304390 44/169 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583486
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.