DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31524 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:234 Identity:57/234 - (24%)
Similarity:92/234 - (39%) Gaps:42/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 IKTEILSVDPFVILLHDMVSHK--------------EGALIRSSSKNQILPSETVNAANEFEI-- 367
            :|.|:::..|.:::..|:.:.|              |..|:.:...|.|:  ..:..||..::  
 Worm    22 VKVEVVAWRPGLVIYRDLFTGKQVRDHLELMEHLKFEEQLVVNDDGNDIV--SKIRRANGTQVFH 84

  Fly   368 AKFRTSKSVWFDSDANEATLKLTQRLGEATGLDMKHSEPFQVINYGIGGVFESHFDTSLA----- 427
            .....::|:| |:..|           ....|:.|.:|....::|..||.:.:|.|..|.     
 Worm    85 EDHPAARSIW-DTAKN-----------LLPNLNFKTAEDILALSYNPGGHYAAHHDYLLYPSEKE 137

  Fly   428 -DEDRFVNGYIDRLATTLFYLNDVPQGGATHFPGLNITVFPKFGTVLMWYNLHTEGMLHVRTMHT 491
             ||...|||  :|..|.:........||||.||.|...|..|.|....|:|..........:.|.
 Worm   138 WDEWMRVNG--NRFGTLIMAFGAAESGGATVFPRLGAAVRTKPGDAFFWFNAMGNSEQEDLSEHA 200

  Fly   492 GCPVIVGSKWVVSKWIDDKGQEFRRPCLRSRLDSKYLSS 530
            |||:..|.|.:.:.|:..:.|    |.|...|.|..||:
 Worm   201 GCPIYKGQKQISTIWLRMRDQ----PILEQTLSSDSLSA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528
TPR_11 215..>259 CDD:290150
TPR_2 216..249 CDD:285020
P4Hc 340..507 CDD:214780 45/188 (24%)
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 46/189 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.