DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31524 and P4htm

DIOPT Version :9

Sequence 1:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:273 Identity:70/273 - (25%)
Similarity:99/273 - (36%) Gaps:85/273 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 SGRCEGPRKLNRLYCVYNCVTAPFLRLAPIKTEILSVDPFVIL-LHD----MVSHKEGALIRSSS 349
            :||...|..:..:|..        ::..|....:||:..|..: |.|    |.|||..:      
  Rat   219 NGRWMTPENIQEMYSA--------IKADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAES------ 269

  Fly   350 KNQILPSETVNAANEFEIAKFRTSKSVWF--DSDANEATLKLTQRLGEATGLD---MKHSEPFQV 409
                  ||.|           |.|...|.  ...|:.....:.||:...|.|.   ::.|||.||
  Rat   270 ------SELV-----------RNSHHTWLHQGEGAHHVMRAIRQRVLRLTRLSPEIVELSEPLQV 317

  Fly   410 INYGIGGVFESHFD------------TSLADEDRFVNGYIDRLATTLFYLNDVPQGGATHFPGL- 461
            :.||.||.:.:|.|            |.|...:........|..|.|||||:|..||.|.||.. 
  Rat   318 VRYGEGGHYHAHVDSGPVYPETVCSHTKLVANESVPFETSCRYMTVLFYLNNVTGGGETVFPVAD 382

  Fly   462 --------------------------NITVFPKFGTVLMWYNLHTEGMLHV-----RTMHTGCPV 495
                                      |:.|.|:.||.:.|||...:|...|     .::|.||.|
  Rat   383 NRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGEVDDYSLHGGCLV 447

  Fly   496 IVGSKWVVSKWID 508
            ..|:||:.:.||:
  Rat   448 TRGTKWIANNWIN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528
TPR_11 215..>259 CDD:290150
TPR_2 216..249 CDD:285020
P4Hc 340..507 CDD:214780 55/215 (26%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 8/41 (20%)
P4Hc 247..459 CDD:214780 61/234 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.