DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31524 and phy-3

DIOPT Version :9

Sequence 1:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_507251.2 Gene:phy-3 / 188624 WormBaseID:WBGene00004026 Length:318 Species:Caenorhabditis elegans


Alignment Length:208 Identity:52/208 - (25%)
Similarity:97/208 - (46%) Gaps:12/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 CVTAPFLRLAPIKTEILSVDPFVILLHDMVSHKEGA-LIRSSSKNQILPSETVNAANEFEIAKFR 371
            |:|..: .:.|:..||:|..|.:::..:::|.::.| .:....:..:...:|.:.....|....|
 Worm    73 CITYVY-NMLPVDMEIISWAPTLVIYRNLMSPRQTASFLNFIEQRDLEIQKTSDFGTSIETTHRR 136

  Fly   372 TSKSVWFDSDAN---EATLKLTQRLGEATGLDMKHSEPFQVINYGIGGVFESHFD----TSLADE 429
            .:.|.....|:|   |..::..:|:   .||::..:|.|..::|..||.:..|:|    .|..|.
 Worm   137 ANGSFIPPEDSNVTVEIKMQAQKRI---PGLNLTVAEHFSALSYLPGGHYAVHYDYLDYRSKQDY 198

  Fly   430 DRFVNGYIDRLATTLFYLNDVPQGGATHFPGLNITVFPKFGTVLMWYNLHTEGMLHVRTMHTGCP 494
            |.::|...:|:.|.:|.|....:||.|.||.:..||....|....|:|...:....:.:.|.|||
 Worm   199 DWWMNKTGNRIGTLIFVLKPAEKGGGTVFPSIGSTVRANAGDAFFWFNAQADEEKEMLSNHGGCP 263

  Fly   495 VIVGSKWVVSKWI 507
            :..|.|.:.:.||
 Worm   264 IYEGRKVIATIWI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528
TPR_11 215..>259 CDD:290150
TPR_2 216..249 CDD:285020
P4Hc 340..507 CDD:214780 42/174 (24%)
phy-3NP_507251.2 P4Hc 102..277 CDD:214780 45/178 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.